DEDD2 Rabbit Polyclonal Antibody

SKU TA340269

Rabbit Polyclonal Anti-DEDD2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DEDD2 antibody: synthetic peptide directed towards the middle region of human DEDD2. Synthetic peptide located within the following region: PQQQSEPARPSSEGKVTCDIRLRVRAEYCEHGPALEQGVASRRPQALARQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 36
• Gene Name: death effector domain containing 2
• Database Link:
  NP_579874
  Q8WXF8
• Background: DEDD2 may play a critical role in death receptor-induced apoptosis and may target CASP8 and CASP10 to the nucleus. DEDD2 may regulate degradation of intermediate filaments during apoptosis. DEDD2 may play a role in the general transcription machinery in the nucleus and might be an important regulator of the activity of GTF3C3.
• Synonyms: FLAME-3; FLAME3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors