DNAAF4 Rabbit Polyclonal Antibody

SKU TA340262

Rabbit Polyclonal Anti-DYX1C1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DYX1C1 antibody: synthetic peptide directed towards the C terminal of human DYX1C1. Synthetic peptide located within the following region: FATENYLAAINAYNLAIRLNNKMPLLYLNRAACHLKLKNLHKAIEDSSKA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 48 kDa
• Gene Name: dyslexia susceptibility 1 candidate 1
• Database Link:
  NP_570722
  Q8WXU2
• Background: DYX1C1contains 1 CS domain and 3 TPR repeats. A chromosomal aberration, translocation t(2;15)(q11;q21), involving DYX1C1 may be a cause of dyslexia.
• Synonyms: CILD25; DNAAF4; DYX1; DYXC1; EKN1; RD
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%

Reference Data