MOBKL2A (MOB3A) Rabbit Polyclonal Antibody

SKU TA340258

Rabbit Polyclonal Anti-MOB3A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MOB3A antibody: synthetic peptide directed towards the middle region of human MOB3A. Synthetic peptide located within the following region: EYRWQDEHKFRKPTALSAPRYMDLLMDWIEAQINNEDLFPTNVGTPFPKN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 25 kDa
• Gene Name: MOB kinase activator 3A
• Database Link:
  NP_570719
  Q96BX8
• Background: MOB3A may regulate the activity of kinases.
• Synonyms: MOB-LAK; MOB1C; MOBKL2A; moblak
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Horse: 93%; Mouse: 93%; Bovine: 93%; Dog: 86%; Zebrafish: 86%; Pig: 80%; Guinea pig: 80%; Rabbit: 79%

Reference Data