OriGene Logo

ASZ1 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA340257
Rabbit Polyclonal Anti-ASZ1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY408931 Transient overexpression lysate of ankyrin repeat, SAM and basic leucine zipper domain containing 1 (ASZ1), transcript variant 1 100 ug
$665.00
TP319070 Recombinant protein of human ankyrin repeat, SAM and basic leucine zipper domain containing 1 (ASZ1), transcript variant 1, 20 µg
20 ug
$867.00

View other "ASZ1 or NM_130768" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ASZ1 antibody: synthetic peptide directed towards the middle region of human ASZ1. Synthetic peptide located within the following region: GKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTICKILTTDSDR
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 53 kDa
Gene Name ankyrin repeat, SAM and basic leucine zipper domain containing 1
Database Link
Background ASZ1 plays a central role during spermatogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity.ASZ1 acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons. Its association with pi-bodies suggests a participation in the primary piRNAs metabolic process.ASZ1 is required prior to the pachytene stage to facilitate the production of multiple types of piRNAs, including those associated with repeats involved in regulation of retrotransposons.ASZ1 may act by mediating protein-protein interactions during germ cell maturation.
Synonyms ALP1; ANKL1; C7orf7; CT1.19; GASZ; Orf3
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Sheep: 93%; Bovine: 93%
Reference Data
Protein Categories Intracellular Proteins, Membrane Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.