Dynein (DYNLL2) Rabbit Polyclonal Antibody

SKU TA340243

Rabbit Polyclonal Anti-DYNLL2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DYNLL2 antibody: synthetic peptide directed towards the N terminal of human DYNLL2. Synthetic peptide located within the following region: MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKY
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 10 kDa
• Gene Name: dynein light chain LC8-type 2
• Database Link:
  NP_542408
  Q96FJ2
• Background: DYNLL2 belongs to the dynein light chain family. DYNLL2 may be involved in some aspects of dynein-related intracellular transport and motility. It may play a role in changing or maintaining the spatial distribution of cytoskeletal structures.
• Synonyms: Dlc2; DNCL1B; RSPH22
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data