ERI2 Rabbit Polyclonal Antibody

SKU TA340240

Rabbit Polyclonal Anti-ERI2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ERI2 antibody: synthetic peptide directed towards the middle region of human ERI2. Synthetic peptide located within the following region: LQEVGIEFSGREHSGLDDSRNTALLAWKMIRDGCVMKITRSLNKGPFLLP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 37 kDa
• Gene Name: ERI1 exoribonuclease family member 2
• Database Link:
  NP_542394
  A8K979
• Background: EXOD1 belongs to the EXOD1 family. It contains 1 exonuclease domain. EXOD1 is a member of a new subclass of exonucleases called the 3'hExo/ERI-1 subfamily of DEDDh nucleases.
• Synonyms: EXOD1; ZGRF5
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 92%; Bovine: 92%; Zebrafish: 85%; Goat: 77%; Yeast: 75%

Reference Data