KLHL32 Rabbit Polyclonal Antibody

SKU TA340218

Rabbit Polyclonal Anti-KLHL32 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KLHL32 antibody: synthetic peptide directed towards the middle region of human KLHL32. Synthetic peptide located within the following region: DVSREGKEEVFYGPTLPFASNGIAACFLPAPYFTCPNLQTLQVPHHRIGT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 70 kDa
• Gene Name: kelch like family member 32
• Database Link:
  NP_443136
  Q96NJ5
• Background: The specific function of KLHL32 is not yet known.
• Synonyms: BKLHD5; dJ21F7.1; KIAA1900; UG0030H05
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data