RAB40B Rabbit Polyclonal Antibody

SKU TA340141

Rabbit Polyclonal Anti-RAB40B Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RAB40B antibody: synthetic peptide directed towards the middle region of human RAB40B. Synthetic peptide located within the following region: YAERLGVTFFEVSPLCNFNITESFTELARIVLLRHGMDRLWRPSKVLSLQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 31 kDa
• Gene Name: RAB40B, member RAS oncogene family
• Database Link:
  NP_006813
  Q12829
• Background: RAB40B has similarity to a yeast protein which suggests a role of the gene product in regulating secretory vesicles.The protein encoded by this gene has similarity to a yeast protein which suggests a role of the gene product in regulating secretory vesicles.
• Synonyms: RAR; SEC4L
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Horse: 92%; Bovine: 92%; Yeast: 82%

Reference Data

• Protein Families: Druggable Genome