RFPL2 Rabbit Polyclonal Antibody

SKU
TA340120
Rabbit Polyclonal Anti-RFPL2 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RFPL2 antibody: synthetic peptide directed towards the C terminal of human RFPL2. Synthetic peptide located within the following region: VSFFDAESGSHVYTFRSVSAEEPLRPFLAPSVPPNGDQGVLSICPLMNSG
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 32 kDa
Gene Name ret finger protein like 2
Database Link
Background RFPL2 contains 1 B30.2/SPRY domain and 1 RING-type zinc finger. The human RFPL2 gene has a role in neocortex development.
Synonyms RNF79
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 85%
Reference Data
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:RFPL2 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.