RPC62 (POLR3C) Rabbit Polyclonal Antibody

SKU TA340114

Rabbit Polyclonal Anti-POLR3C Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-POLR3C antibody: synthetic peptide directed towards the middle region of human POLR3C. Synthetic peptide located within the following region: VEAIIASMQATGAEEAQLQEIEEMITAPERQQLETLKRNVNKLDASEIQV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 60 kDa
• Gene Name: polymerase (RNA) III subunit C
• Database Link:
  NP_006459
  Q9BUI4
• Background: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3C is a specific core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. POLR3C may direct with other members of the subcomplex RNA Pol III binding to the TFIIIB-DNA complex via the interactions between TFIIIB and POLR3F. POLR3C may be involved either in the recruitment and stabilization of the subcomplex within RNA polymerase III, or in stimulating catalytic functions of other subunits during initiation. POLR3C plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses.POLR3C acts as nuclear and cytosolic DNA sensor involved in innate immune response. POLR3C can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway.
• Synonyms: RPC3; RPC62
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Yeast: 90%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase