HRSP12 (RIDA) Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-HRSP12 antibody: synthetic peptide directed towards the N terminal of human HRSP12. Synthetic peptide located within the following region: MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGG |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 14 |
Gene Name | reactive intermediate imine deaminase A homolog |
Database Link | |
Background | HRSP12 is an endoribonuclease responsible for the inhibition of the translation by cleaving mRNA.HRSP12 inhibits cell-free protein synthesis. HRSP12 cleaves phosphodiester bonds only in single-stranded RNA. |
Synonyms | P14.5; PSP; UK114 |
Note | Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Goat: 93%; Bovine: 93%; Rabbit: 93% |
Reference Data |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.