HRSP12 (RIDA) Rabbit Polyclonal Antibody

SKU TA340083

Rabbit Polyclonal Anti-HRSP12 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HRSP12 antibody: synthetic peptide directed towards the N terminal of human HRSP12. Synthetic peptide located within the following region: MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 14
• Gene Name: reactive intermediate imine deaminase A homolog
• Database Link:
  NP_005827
  P52758
• Background: HRSP12 is an endoribonuclease responsible for the inhibition of the translation by cleaving mRNA.HRSP12 inhibits cell-free protein synthesis. HRSP12 cleaves phosphodiester bonds only in single-stranded RNA.
• Synonyms: P14.5; PSP; UK114
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Goat: 93%; Bovine: 93%; Rabbit: 93%

Reference Data