Endo G (ENDOG) Rabbit Polyclonal Antibody

SKU TA340055

Rabbit Polyclonal Anti-ENDOG Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ENDOG antibody: synthetic peptide directed towards the middle region of human ENDOG. Synthetic peptide located within the following region: YVMPNAPVDEAIPLERFLVPIESIERASGLLFVPNILARAGSLKAITAGS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 28 kDa
• Gene Name: endonuclease G
• Database Link:
  NP_004426
  Q14249
• Background: ENDOG cleaves DNA at double-stranded (DG)n.(DC)n and at single-stranded (DC)n tracts. In addition to deoxyribonuclease activities, ENDOG also has ribonuclease (RNase) and RNase H activities. ENDOG is capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA.The protein encoded by this gene is a nuclear encoded endonuclease that is localized in the mitochondrion. The encoded protein is widely distributed among animals and cleaves DNA at GC tracts. This protein is capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA.
• Synonyms: FLJ27463
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Zebrafish: 100%; Guinea pig: 100%; Bovine: 93%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Apoptosis