OriGene Logo

DYNC1I1 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA340052
Rabbit Polyclonal Anti-DYNC1I1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY427617 Transient overexpression lysate of dynein, cytoplasmic 1, intermediate chain 1 (DYNC1I1), transcript variant 3 100 ug
$436.00
TP317108 Recombinant protein of human dynein, cytoplasmic 1, intermediate chain 1 (DYNC1I1), transcript variant 1, 20 µg
20 ug
$737.00

View other "DYNC1I1 or NM_004411" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-DYNC1I1 antibody: synthetic peptide directed towards the N terminal of human DYNC1I1. Synthetic peptide located within the following region: IREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGISP
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 73 kDa
Gene Name dynein cytoplasmic 1 intermediate chain 1
Database Link
Background DYNC1I1 belongs to the dynein intermediate chain family. It contains 7 WD repeats. The intermediate chains seem to help dynein bind to dynactin 150 kDa component. DYNC1I1 may play a role in mediating the interaction of cytoplasmic dynein with membranous organelles and kinetochores.
Synonyms DNCI1; DNCIC1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.