DYNC1I1 Rabbit Polyclonal Antibody

SKU TA340052

Rabbit Polyclonal Anti-DYNC1I1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DYNC1I1 antibody: synthetic peptide directed towards the N terminal of human DYNC1I1. Synthetic peptide located within the following region: IREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGISP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 73 kDa
• Gene Name: dynein cytoplasmic 1 intermediate chain 1
• Database Link:
  NP_004402
  O14576
• Background: DYNC1I1 belongs to the dynein intermediate chain family. It contains 7 WD repeats. The intermediate chains seem to help dynein bind to dynactin 150 kDa component. DYNC1I1 may play a role in mediating the interaction of cytoplasmic dynein with membranous organelles and kinetochores.
• Synonyms: DNCI1; DNCIC1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%

Reference Data