CHI3L1 Rabbit Polyclonal Antibody

SKU TA340002

Rabbit Polyclonal Anti-CHI3L1 Antibody

Product Data

• Application: IF, WB
• Recommended Dilution: WB, IF
• Reactivity: Human, SimianIVE
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CHI3L1 antibody: synthetic peptide directed towards the middle region of human CHI3L1. Synthetic peptide located within the following region: LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 42 kDa
• Gene Name: chitinase 3 like 1
• Database Link:
  NP_001267
  P36222
• Background: CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment. CHI3L1 may play a role in tissue remodeling and defense against pathogens. It belongs to the glycosyl hydrolase 18 family. CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment.
• Synonyms: ASRT7; CGP-39; GP-39; GP39; HC-gp39; HCGP-3P; hCGP-39; YKL-40; YKL40; YYL-40
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Pig: 92%; Goat: 92%; Bovine: 92%; Dog: 77%; Rat: 77%

Reference Data

• Protein Families: Secreted Protein