Carboxypeptidase N subunit 2 (CPN2) Rabbit Polyclonal Antibody

SKU TA339984

Rabbit Polyclonal Anti-CPN2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CPN2 antibody: synthetic peptide directed towards the N terminal of human CPN2. Synthetic peptide located within the following region: FTTLETRAFGSNPNLTKVVFLNTQLCQFRPDAFGGLPRLEDLEVTGSSFL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 60 kDa
• Gene Name: carboxypeptidase N subunit 2
• Database Link:
  NP_001073982
  P22792
• Background: CPN2 contains 13 LRR (leucine-rich) repeats. The 83 kDa subunit binds and stabilizes the catalytic subunit at 37 degrees Celsius and keeps it in circulation. Under some circumstances it may be an allosteric modifier of the catalytic subunit.
• Synonyms: ACBP
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 91%; Mouse: 91%; Bovine: 91%; Horse: 86%; Pig: 79%

Reference Data