LIPJ Rabbit Polyclonal Antibody

CAT#: TA339956

Rabbit Polyclonal Anti-LIPJ Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "LIPJ"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-LIPJ antibody: synthetic peptide directed towards the C terminal of human LIPJ. Synthetic peptide located within the following region: LNLVHYNQTTSPLYNMTNMNVATAIWNGKSDLLADPEDVNILHSEITNHI
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 42 kDa
Gene Name lipase family member J
Background LIPJ belongs to the AB hydrolase superfamily, lipase family. The exact function of LIPJ remains unknown.
Synonyms bA425M17.2; LIPL1
Note Immunogen Sequence Homology: Human: 100%; Horse: 92%; Bovine: 92%; Rabbit: 85%; Rat: 83%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.