LIPJ Rabbit Polyclonal Antibody

SKU TA339956

Rabbit Polyclonal Anti-LIPJ Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LIPJ antibody: synthetic peptide directed towards the C terminal of human LIPJ. Synthetic peptide located within the following region: LNLVHYNQTTSPLYNMTNMNVATAIWNGKSDLLADPEDVNILHSEITNHI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 42 kDa
• Gene Name: lipase family member J
• Database Link:
  NP_001010939
  Q5W064
• Background: LIPJ belongs to the AB hydrolase superfamily, lipase family. The exact function of LIPJ remains unknown.
• Synonyms: bA425M17.2; LIPL1
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 92%; Bovine: 92%; Rabbit: 85%; Rat: 83%

Reference Data

• Protein Families: Druggable Genome