ZSCAN5 (ZSCAN5A) Rabbit Polyclonal Antibody

SKU
TA339859
Rabbit Polyclonal Anti-ZSCAN5A Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ZSCAN5A antibody is: synthetic peptide directed towards the middle region of human ZSCAN5A. Synthetic peptide located within the following region: GNRGDALNLSSPKRSKPDASSISQEEPQGEATPVGNRESPGQAGMNSIHS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 38 kDa
Gene Name zinc finger and SCAN domain containing 5A
Database Link
Background The function of this protein remains unknown.
Synonyms ZNF495; ZSCAN5
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:ZSCAN5 (ZSCAN5A) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.