ZNF12 Rabbit Polyclonal Antibody

SKU TA339856

Rabbit Polyclonal Anti-ZNF12 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF12 antibody is: synthetic peptide directed towards the N-terminal region of Human ZNF12. Synthetic peptide located within the following region: EWQQLDPEQKITYRDVMLENYSNLVSVGYHIIKPDVISKLEQGEEPWIVE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 72 kDa
• Gene Name: zinc finger protein 12
• Database Link:
  NP_008887
  P17014
• Background: This gene is a member of the krueppel C2H2-type zinc-finger protein family and encodes a protein with eight C2H2-type zinc fingers and a KRAB domain. This nuclear protein is involved in developmental control of gene expression. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Synonyms: GIOT-3; HZF11; KOX3; ZNF325
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 85%; Bovine: 77%

Reference Data

• Protein Families: Transcription Factors