ZNF662 Rabbit Polyclonal Antibody

SKU
TA339848
Rabbit Polyclonal Anti-ZNF662 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF662 antibody: synthetic peptide directed towards the middle region of human ZNF662. Synthetic peptide located within the following region: QIFYICEECGKCFDQNEDFDQHQKTHNGEKVYGCKECGKAFSFRSHCIAH
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 51 kDa
Gene Name zinc finger protein 662
Database Link
Background The function of this protein remains unknown.
Synonyms FLJ33347; FLJ45880; MGC149141
Note Immunogen Sequence Homology: Human: 100%; Pig: 86%; Dog: 79%; Horse: 79%
Reference Data
Write Your Own Review
You're reviewing:ZNF662 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.