TCEAL2 Rabbit Polyclonal Antibody

SKU TA339784

Rabbit Polyclonal Anti-TCEAL2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TCEAL2 antibody: synthetic peptide directed towards the N terminal of human TCEAL2. Synthetic peptide located within the following region: MEKLFNENEGMPSNQGKIDNEEQPPHEGKPEVACILEDKKLENEGNTENT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 26 kDa
• Gene Name: transcription elongation factor A like 2
• Database Link:
  NP_525129
  Q9H3H9
• Background: TCEAL2 is a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner.This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located on the X chromosome.
• Synonyms: my048; MY0876G05; WEX1
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data