STK31 Rabbit Polyclonal Antibody

SKU TA339776

Rabbit Polyclonal Anti-STK31 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-STK31 antibody: synthetic peptide directed towards the N terminal of human STK31. Synthetic peptide located within the following region: SPIPLWGHRSNQSTFSRPKGHLSEKMTLDLKDENDAGNLITFPKESLAVG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 113 kDa
• Gene Name: serine/threonine kinase 31
• Database Link:
  NP_116562
  Q9BXU1
• Background: This gene is similar to a mouse gene that encodes a putative protein kinase with a tudor domain, and shows testis-specific expression. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Synonyms: SGK396; TDRD8
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Dog: 85%; Horse: 85%; Bovine: 77%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase