ARID5B Rabbit Polyclonal Antibody

SKU TA339767

Rabbit Polyclonal Anti-ARID5B Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ARID5B antibody: synthetic peptide directed towards the C terminal of human ARID5B. Synthetic peptide located within the following region: VSPLDPSKEVSGKEKASEQESEGSKAAHGGHSGGGSEGHKLPLSSPIFPG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 132 kDa
• Gene Name: AT-rich interaction domain 5B
• Database Link:
  NP_115575
  Q14865
• Background: ARID5B is a DNA-binding protein that binds to the 5'-AATA[CT]-3' core sequence. ARID5B probably acts as a transcription regulator. ARID5B represses the cytomegalovirus enhancer. Overexpression of ARID5B leads to induction of smooth muscle marker genes, suggesting that it may act as a regulator of smooth muscle cell differentiation and proliferation. ARID5B may be involved in lipid stores.
• Synonyms: DESRT; MRF-2; MRF2
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%; Pig: 86%; Guinea pig: 86%

Reference Data