OriGene Logo

TRAPPC2 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA339715
Rabbit Polyclonal Anti-TRAPPC2 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY415200 Transient overexpression lysate of trafficking protein particle complex 2 (TRAPPC2), transcript variant 2 100 ug
$436.00
TP324275 Recombinant protein of human trafficking protein particle complex 2 (TRAPPC2), transcript variant 2, 20 µg
20 ug
$867.00

View other "TRAPPC2 or NM_014563" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TRAPPC2 antibody: synthetic peptide directed towards the middle region of human TRAPPC2. Synthetic peptide located within the following region: RQEDGIKNFFTDVYDLYIKFSMNPFYEPNSPIRSSAFDRKVQFLGKKHLL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 16 kDa
Gene Name trafficking protein particle complex 2
Database Link
Background TRAPPC2 prevents MBP1-mediated transcriptional repression and antagonizes MBP1-mediated cell death. TRAPPC2 may play a role in vesicular transport from endoplasmic reticulum to Golgi.The protein encoded by this gene is thought to be part of a large multisubunit complex involved in the targeting and fusion of endoplasmic reticulum-to-Golgi transport vesicles with their acceptor compartment. In addition, the encoded protein can bind MBP1 and block its transcriptional repression capability. Mutations in this gene are a cause of spondyloepiphyseal dysplasia tarda (SEDT). A processed pseudogene of this gene is located on chromosome 19, and other pseuodogenes are found on chromosomes 8 and Y. Alternatively spliced transcript variants encoding distinct isoforms or having different 5' UTRs, have been found for this gene.
Synonyms hYP38334; MIP2A; SEDL; SEDT; TRAPPC2P1; TRS20; ZNF547L
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 86%
Reference Data
Protein Categories Intracellular Proteins
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.