LIMD1 Rabbit Polyclonal Antibody

SKU TA339713

Rabbit Polyclonal Anti-LIMD1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LIMD1 antibody: synthetic peptide directed towards the N terminal of human LIMD1. Synthetic peptide located within the following region: MDKYDDLGLEASKFIEDLNMYEASKDGLFRVDKGAGNNPEFEETRRVFAT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 56 kDa
• Gene Name: LIM domains containing 1
• Database Link:
  NP_055055
  Q9UGP4
• Background: LIMD1 may be involved in cell anchoring via focal adhesions and in the cell cycle, particularly during mitosis. LIMD1 functionally interacts with pRB and the loss of which promotes lung carcinogenesis. Some breast tumors also have altered expression of LIMD1 RNA. LIMD1 may represent a critical tumor suppressor gene.
• Synonyms: LIM domains containing 1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 93%; Rabbit: 86%

Reference Data