Zinc finger protein 460 (ZNF460) Rabbit Polyclonal Antibody

SKU TA339705

Rabbit Polyclonal Anti-ZNF460 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF460 antibody: synthetic peptide directed towards the N terminal of human ZNF460. Synthetic peptide located within the following region: ALYVEVMLETCGLLVALGDSTKPETVEPIPSHLALPEEVSLQEQLAQGVP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 64 kDa
• Gene Name: zinc finger protein 460
• Database Link:
  NP_006626
  Q14592
• Background: ZNF460 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 11 C2H2-type zinc fingers and 1 KRAB domain. ZNF460 may be involved in transcriptional regulation.Zinc finger proteins, such as ZNF272, interact with nucleic acids and have diverse functions. The zinc finger domain is a conserved amino acid sequence motif containing 2 specifically positioned cysteines and 2 histidines that are involved in coordinating zinc. Kruppel-related proteins form 1 family of zinc finger proteins. See ZFP93 (MIM 604749) for additional information on zinc finger proteins. [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-322 DA991801.1 1-322 323-2011 BC118625.1 1-1689 2012-3494 AC005261.2 120007-121489 3495-3849 AK074582.1 1463-1817
• Synonyms: HZF8; ZNF272
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data