OriGene Logo

Zinc finger protein 460 (ZNF460) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA339705
Rabbit Polyclonal Anti-ZNF460 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY416523 Transient overexpression lysate of zinc finger protein 460 (ZNF460) 100 ug
$665.00

View other "Zinc finger protein 460 or NM_006635" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF460 antibody: synthetic peptide directed towards the N terminal of human ZNF460. Synthetic peptide located within the following region: ALYVEVMLETCGLLVALGDSTKPETVEPIPSHLALPEEVSLQEQLAQGVP
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 64 kDa
Gene Name zinc finger protein 460
Database Link
Background ZNF460 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 11 C2H2-type zinc fingers and 1 KRAB domain. ZNF460 may be involved in transcriptional regulation.Zinc finger proteins, such as ZNF272, interact with nucleic acids and have diverse functions. The zinc finger domain is a conserved amino acid sequence motif containing 2 specifically positioned cysteines and 2 histidines that are involved in coordinating zinc. Kruppel-related proteins form 1 family of zinc finger proteins. See ZFP93 (MIM 604749) for additional information on zinc finger proteins. supplied by OMIM. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-322 DA991801.1 1-322 323-2011 BC118625.1 1-1689 2012-3494 AC005261.2 120007-121489 3495-3849 AK074582.1 1463-1817
Synonyms HZF8; ZNF272
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Categories Intracellular Proteins, Transciption Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.