FHL3 Rabbit Polyclonal Antibody

SKU TA339681

Rabbit Polyclonal Anti-FHL3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FHL3 antibody: synthetic peptide directed towards the middle region of human FHL3. Synthetic peptide located within the following region: HRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 31 kDa
• Gene Name: four and a half LIM domains 3
• Database Link:
  NP_004459
  Q13643
• Background: FHL3 contains 4 LIM zinc-binding domains. It is expressed only in skeletal muscle. FHL3 association with MyoD may contribute to the regulation of MyoD-dependent transcription of muscle genes and thereby myogenesis.LIM proteins are defined by the possession of a highly conserved double zinc finger motif called the LIM domain. [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: SLIM2
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Rabbit: 93%; Mouse: 92%; Bovine: 86%; Guinea pig: 86%; Zebrafish: 82%

Reference Data