OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FHL3 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA339681
Rabbit Polyclonal Anti-FHL3 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY417968 Transient overexpression lysate of four and a half LIM domains 3 (FHL3) (as WB positive control) 100 ug
$436.00
TP303991 Recombinant protein of human four and a half LIM domains 3 (FHL3), 20 µg
20 ug
$867.00

View other "FHL3 or NM_004468" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-FHL3 antibody: synthetic peptide directed towards the middle region of human FHL3. Synthetic peptide located within the following region: HRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 31 kDa
Gene Name four and a half LIM domains 3
Database Link
Background FHL3 contains 4 LIM zinc-binding domains. It is expressed only in skeletal muscle. FHL3 association with MyoD may contribute to the regulation of MyoD-dependent transcription of muscle genes and thereby myogenesis.LIM proteins are defined by the possession of a highly conserved double zinc finger motif called the LIM domain. supplied by OMIM. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms SLIM2
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Rabbit: 93%; Mouse: 92%; Bovine: 86%; Guinea pig: 86%; Zebrafish: 82%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products