ZFYVE19 Rabbit Polyclonal Antibody

SKU TA339668

Rabbit Polyclonal Anti-ZFYVE19 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZFYVE19 antibody: synthetic peptide directed towards the C terminal of human ZFYVE19. Synthetic peptide located within the following region: CNEDATLRCAGCDGDLFCARCFREGHDAFELKEHQTSAYSPPRAGQEH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 51 kDa
• Gene Name: zinc finger FYVE-type containing 19
• Database Link:
  NP_001070736
  Q96K21
• Background: ZFYVE19 contains 1 FYVE-type zinc finger. A chromosomal aberration, translocation t(11;15)(q23;q14) with MLL/HRX, involving ZFYVE19 is associated with acute myeloblastic leukemia (AML).
• Synonyms: ANCHR; MPFYVE
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 79%; Guinea pig: 79%

Reference Data