ZNF226 Rabbit Polyclonal Antibody

SKU
TA339652
Rabbit Polyclonal Anti-ZNF226 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF226 antibody: synthetic peptide directed towards the C terminal of human ZNF226. Synthetic peptide located within the following region: KSFGRSAHLQAHQKVHTGDKPYKCDECGKGFKWSLNLDMHQRVHTGEKPY
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 92 kDa
Gene Name zinc finger protein 226
Database Link
Background ZNF226 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 19 C2H2-type zinc fingers and 1 KRAB domain. ZNF226 may be involved in transcriptional regulation.
Synonyms Kruppel-associated box protein; zinc finger protein 226
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 92%; Mouse: 86%; Guinea pig: 86%; Zebrafish: 85%
Reference Data
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:ZNF226 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.