HELT Rabbit Polyclonal Antibody

SKU TA339650

Rabbit Polyclonal Anti-HELT Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HELT antibody: synthetic peptide directed towards the middle region of human HELT. Synthetic peptide located within the following region: EMTVQYLRALHSADFPRGREKAELLAEFANYFHYGYHECMKNLVHYLTTV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 36 kDa
• Gene Name: helt bHLH transcription factor
• Database Link:
  NP_001025058
  A6NFD8
• Background: HELT belongs to the HEY family. It contains 1 basic helix-loop-helix (bHLH) domain and 1orange domain. HELT is a transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGCG-3'.
• Synonyms: bHLHb44; HCM1228; HESL; Mgn
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 93%

Reference Data