DBX1 Rabbit Polyclonal Antibody

SKU TA339648

Rabbit Polyclonal Anti-DBX1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DBX1 antibody: synthetic peptide directed towards the middle region of human DBX1. Synthetic peptide located within the following region: GGCREQTLPTKLNPHPDLSDVGQKGPGNEEEEEGPGSPSHRLAYHASSDP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 41 kDa
• Gene Name: developing brain homeobox 1
• Database Link:
  NP_001025036
  A6NMT0
• Background: DBX1 could have a role in patterning the central nervous system during embryogenesis. DBX1 has a key role in regulating the distinct phenotypic features that distinguish two major classes of ventral interneurons, V0 and V1 neurons. DBX1 regulates the transcription factor profile, neurotransmitter phenotype, intraspinal migratory path and axonal trajectory of V0 neurons, features that differentiate them from an adjacent set of V1 neurons.
• Synonyms: developing brain homeobox 1
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 86%; Dog: 85%

Reference Data