TMEM118 (RNFT2) Rabbit Polyclonal Antibody

SKU TA339630

Rabbit Polyclonal Anti-RNFT2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMEM118 antibody: synthetic peptide directed towards the N terminal of human TMEM118. Synthetic peptide located within the following region: HGGHRGGSLLQHVGGDHRGHSEEGGDEQPGTPAPALSELKAVICWLQKGL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 46 kDa
• Gene Name: ring finger protein, transmembrane 2
• Database Link:
  NP_116203
  Q96EX2
• Background: RNFT2 is a multi-pass membrane protein, and contains 1 RING-type zinc finger. The function of RNFT2 remains unknown.
• Synonyms: TMEM118
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data

• Protein Families: Transmembrane