ORAI1 Rabbit Polyclonal Antibody

SKU
TA339628
Rabbit Polyclonal Anti-ORAI1 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ORAI1 antibody: synthetic peptide directed towards the middle region of human ORAI1. Synthetic peptide located within the following region: IGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITP
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 33 kDa
Gene Name ORAI calcium release-activated calcium modulator 1
Database Link
Background ORAI1 belongs to the Orai family. ORAI1 (CRACM1) is a plasma membrane protein essential for store-operated calcium entry. Defects in ORAI1 are a cause of severe combined immunodeficiency with CRAC channel dysfunction (CRAC-SCID).CRACM1 is a plasma membrane protein essential for store-operated calcium entry (Vig et al., 2006 [PubMed 16645049]). [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-331 BC075831.1 1-331 332-844 BC013386.1 220-732 845-990 BC075831.1 845-990 991-1490 BG574128.1 52-551 1491-1496 AK027372.1 1235-1240
Synonyms CRACM1; IMD9; ORAT1; TAM2; TMEM142A
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Rabbit: 100%; Horse: 93%; Bovine: 93%; Rat: 86%; Yeast: 77%
Reference Data
Protein Families Transmembrane
Write Your Own Review
You're reviewing:ORAI1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.