SPATA9 Rabbit Polyclonal Antibody

SKU TA339594

Rabbit Polyclonal Anti-SPATA9 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SPATA9 antibody: synthetic peptide directed towards the N terminal of human SPATA9. Synthetic peptide located within the following region: FKDEFPTILRLSQSNQKREPAQKTSKIRMAIALAKINRATLIRGLNSISR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 29 kDa
• Gene Name: spermatogenesis associated 9
• Database Link:
  NP_114158
  Q9BWV2
• Background: SPATA9 may play a role in testicular development/spermatogenesis and may be an important factor in male infertility. Defects in expression of SPATA9 lead to Sertoli-cell-only syndrome.
• Synonyms: NYD-SP16
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Pig: 86%; Bovine: 86%

Reference Data

• Protein Families: Transmembrane