FAM62C (ESYT3) Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-FAM62C antibody: synthetic peptide directed towards the middle region of human FAM62C. Synthetic peptide located within the following region: EVFEFMVYEVPGQDLEVDLYDEDTDRDDFLGSLQICLGDVMTNRVVDEWF |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 100 kDa |
Gene Name | extended synaptotagmin protein 3 |
Database Link | |
Background | ESYT3 belongs to the extended synaptotagmin family. It is a single-pass membrane protein, and contains 3 C2 domains. ESYT3 may play a role as calcium-regulated intrinsic membrane protein. |
Synonyms | CHR3SYT; E-Syt3; FAM62C |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Rabbit: 93%; Horse: 92%; Bovine: 92%; Zebrafish: 77% |
Reference Data | |
Protein Families | Transmembrane |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.