FAM62C (ESYT3) Rabbit Polyclonal Antibody

CAT#: TA339591

Reviews ()
Write a review

Rabbit Polyclonal Anti-ESYT3 Antibody


Product Datasheet for 'TA339591'


Promo! Get it for USD 289.00, only with code 289*.

(*) Valid from April 1st to September 30th, 2020. See details »

USD 375.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-FAM62C antibody: synthetic peptide directed towards the middle region of human FAM62C. Synthetic peptide located within the following region: EVFEFMVYEVPGQDLEVDLYDEDTDRDDFLGSLQICLGDVMTNRVVDEWF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration 1 mg/ml
Purification Protein A purified
Predicted Protein Size 100 kDa
Gene Name extended synaptotagmin protein 3
Background ESYT3 belongs to the extended synaptotagmin family. It is a single-pass membrane protein, and contains 3 C2 domains. ESYT3 may play a role as calcium-regulated intrinsic membrane protein.
Synonyms CHR3SYT; E-Syt3; FAM62C
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Rabbit: 93%; Horse: 92%; Bovine: 92%; Zebrafish: 77%
Reference Data
Protein Families Transmembrane
Other products for "ESYT3"
Frequently bought together (2)
Transient overexpression lysate of extended synaptotagmin-like protein 3 (ESYT3)
    • 100 ug

USD 495.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies