FAM62C (ESYT3) Rabbit Polyclonal Antibody

SKU TA339591

Rabbit Polyclonal Anti-ESYT3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FAM62C antibody: synthetic peptide directed towards the middle region of human FAM62C. Synthetic peptide located within the following region: EVFEFMVYEVPGQDLEVDLYDEDTDRDDFLGSLQICLGDVMTNRVVDEWF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 100 kDa
• Gene Name: extended synaptotagmin protein 3
• Database Link:
  NP_114119
  A0FGR9
• Background: ESYT3 belongs to the extended synaptotagmin family. It is a single-pass membrane protein, and contains 3 C2 domains. ESYT3 may play a role as calcium-regulated intrinsic membrane protein.
• Synonyms: CHR3SYT; E-Syt3; FAM62C
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Rabbit: 93%; Horse: 92%; Bovine: 92%; Zebrafish: 77%

Reference Data

• Protein Families: Transmembrane