Anoctamin 3 (ANO3) Rabbit Polyclonal Antibody

SKU TA339579

Rabbit Polyclonal Anti-ANO3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMEM16C antibody: synthetic peptide directed towards the middle region of human TMEM16C. Synthetic peptide located within the following region: WWSRHKIKRGIHDASIPQWENDWNLQPMNLHGLMDEYLEMVLQFGFTTIF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 115 kDa
• Gene Name: anoctamin 3
• Database Link:
  NP_113606
  Q9BYT9
• Background: ANO3 is a multi-pass membrane proteinPotential. It belongs to the anoctamin family. ANO3 may act as a calcium-activated chloride channel.
• Synonyms: C11orf25; DYT23; DYT24; GENX-3947; TMEM16C
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 86%; Rabbit: 77%

Reference Data

• Protein Families: Transmembrane