FCRL4 Rabbit Polyclonal Antibody

SKU TA339577

Rabbit Polyclonal Anti-FCRL4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FCRL4 antibody: synthetic peptide directed towards the N terminal of human FCRL4. Synthetic peptide located within the following region: KIIKIQELFPHPELKATDSQPTEGNSVNLSCETQLPPERSDTPLHFNFFR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 57 kDa
• Gene Name: Fc receptor like 4
• Database Link:
  NP_112572
  Q96PJ5
• Background: FCRL4 may function as an inhibitor of the B cell receptor signaling and in the B cell-mediated immune response.
• Synonyms: CD307d; FCRH4; IGFP2; IRTA1
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 86%; Horse: 86%; Rabbit: 79%

Reference Data

• Protein Families: Transmembrane