FCRL4 Rabbit Polyclonal Antibody

SKU
TA339576
Rabbit Polyclonal Anti-FCRL4 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-FCRL4 antibody: synthetic peptide directed towards the N terminal of human FCRL4. Synthetic peptide located within the following region: FKGERVTLTCNGFQFYATEKTTWYHRHYWGEKLTLTPGNTLEVRESGLYR
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 57 kDa
Gene Name Fc receptor like 4
Database Link
Background FCRL4 may function as an inhibitor of the B cell receptor signaling and in the B cell-mediated immune response.
Synonyms CD307d; FCRH4; IGFP2; IRTA1
Note Immunogen Sequence Homology: Human: 100%; Pig: 85%
Reference Data
Protein Families Transmembrane
Write Your Own Review
You're reviewing:FCRL4 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.