CTRP1 (C1QTNF1) Rabbit Polyclonal Antibody

SKU TA339574

Rabbit Polyclonal Anti-C1QTNF1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C1QTNF1 antibody: synthetic peptide directed towards the N terminal of human C1QTNF1. Synthetic peptide located within the following region: YPATAVPQINITILKGEKGDRGDRGLQGKYGKTGSAGARGHTGPKGQKGS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 23 kDa
• Gene Name: C1q and tumor necrosis factor related protein 1
• Database Link:
  NP_940996
  Q9BXJ1
• Background: C1QTNF1 may be considered a novel adipokine, providing an important framework to further address the physiological functions and mechanisms of the action of this family of secreted glycoproteins in normal and disease states.It was highly expressed in obese subjects as well as up-regulated in hypertensive patients, and may be a newly identified molecular link between obesity and hypertension.
• Synonyms: CTRP1; GIP; ZSIG37
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 77%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein, Transmembrane