sphingosine 1 phosphate phosphatase 1 (SGPP1) Rabbit Polyclonal Antibody

SKU TA339564

Rabbit Polyclonal Anti-SGPP1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SGPP1 antibody: synthetic peptide directed towards the middle region of human SGPP1. Synthetic peptide located within the following region: THKYAPFIIIGLHLALGIFSFTLDTWSTSRGDTAEILGSGAGIACGSHVT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 49 kDa
• Gene Name: sphingosine-1-phosphate phosphatase 1
• Database Link:
  NP_110418
  Q9BX95
• Background: Sphingosine-1-phosphate (S1P) is a bioactive sphingolipid metabolite that regulates diverse biologic processes. SGPP1 catalyzes the degradation of S1P via salvage and recycling of sphingosine into long-chain ceramides (Mandala et al., 2000 [PubMed 10859351]; Le Stunff et al., 2007 [PubMed 17895250]).
• Synonyms: SPPase1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome, Phosphatase, Transmembrane
• Protein Pathways: Sphingolipid metabolism