CDA08 (ITFG1) Rabbit Polyclonal Antibody

SKU TA339563

Rabbit Polyclonal Anti-ITFG1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ITFG1 antibody: synthetic peptide directed towards the N terminal of human ITFG1. Synthetic peptide located within the following region: TAELFGAEAWGTLAAFGDLNSDKQTDLFVLRERNDLIVFLADQNAPYFKP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 68 kDa
• Gene Name: integrin alpha FG-GAP repeat containing 1
• Database Link:
  NP_110417
  Q8TB96
• Background: ITFG1 belongs to the TIP family. It contains 1 FG-GAP repeat. ITFG1 is a modulator of T-cell function. It has a protective effect in graft versus host disease model.
• Synonyms: 2310047C21Rik; CDA08; LNKN-1; TIP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 75%

Reference Data

• Protein Families: Secreted Protein, Transmembrane