DCSTAMP Rabbit Polyclonal Antibody

SKU
TA339561
Rabbit Polyclonal Anti-DCSTAMP Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TM7SF4 antibody: synthetic peptide directed towards the N terminal of human TM7SF4. Synthetic peptide located within the following region: AGTGIVILGHVENIFHNFKGLLDGMTCNLRAKSFSIHFPLLKKYIEAIQW
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 53 kDa
Gene Name dendrocyte expressed seven transmembrane protein
Database Link
Background Dendritic cells are unique in their ability to present antigen to naive T cells, and therefore play a central role in the initiation of immune responses. The protein encoded by this gene is a transmembrane molecule that is preferentially expressed by dendritic cells. Its expression is down-regulated by ligation of the CD40 molecule. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
Synonyms FIND; hDC-STAMP; TM7SF4
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Mouse: 92%
Reference Data
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:DCSTAMP Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.