ZNF649 Rabbit Polyclonal Antibody

CAT#: TA339543

Rabbit Polyclonal Anti-FLJ12644 Antibody


USD 485.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of zinc finger protein 649 (ZNF649)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "ZNF649"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-FLJ12644 antibody: synthetic peptide directed towards the C terminal of human FLJ12644. Synthetic peptide located within the following region: EKAYFYMSCLVKHKRIHSREKRGDSVKVENPSTASHSLSPSEHVQGKSPV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 58 kDa
Gene Name zinc finger protein 649
Background The FLJ12644 gene encodes a protein may act as a transcriptional repressor in mitogen-activated protein kinase signaling pathway to mediate cellular functions.
Synonyms FLJ12644
Note Immunogen Sequence Homology: Human: 100%; Dog: 77%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.