ZNF307 (ZKSCAN4) Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZNF307 antibody: synthetic peptide directed towards the N terminal of human ZNF307. Synthetic peptide located within the following region: MAREPRKNAALDAQSAEDQTGLLTVKVEKEEASALTAEVRAPCSPARGPE |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 62 kDa |
Gene Name | zinc finger with KRAB and SCAN domains 4 |
Database Link | |
Background | ZNF307 contains 1 SCAN box domain, 1 KRAB domain and 7 C2H2-type zinc fingers. It belongs to the Krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation. |
Synonyms | P1P373C6; ZNF307; ZNF427; ZSCAN36 |
Note | Immunogen Sequence Homology: Horse: 100%; Human: 100%; Bovine: 92%; Rabbit: 85% |
Reference Data | |
Protein Families | Transcription Factors |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.