PHF20 Rabbit Polyclonal Antibody

SKU TA339488

Rabbit Polyclonal Anti-PHF20 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PHF20 antibody: synthetic peptide directed towards the C terminal of human PHF20. Synthetic peptide located within the following region: GSALDDAVNPLHENGDDSLSPRLGWPLDQDRSKGDSDPKPGSPKVKEYVS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 83 kDa
• Gene Name: PHD finger protein 20
• Database Link:
  NP_057520
  Q9BVI0
• Background: PHF20 is a possible transcription factor.
• Synonyms: C20orf104; GLEA2; HCA58; NZF; TDRD20A; TZP
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Bovine: 92%; Rabbit: 92%; Horse: 83%; Guinea pig: 83%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors