MLX interacting protein (MLXIP) Rabbit Polyclonal Antibody

SKU TA339476

Rabbit Polyclonal Anti-MLXIP Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MLXIP antibody: synthetic peptide directed towards the middle region of human MLXIP. Synthetic peptide located within the following region: DEQGCEHTSRTEDPFIQPTDFGPSEPPLSVPQPFLPVFTMPLLSPSPAPP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 101 kDa
• Gene Name: MLX interacting protein
• Database Link:
  NP_055753
  Q9HAP2
• Background: This gene encodes a protein that functions as part of a heterodimer to activate transcription. The encoded protein forms a heterodimer with Max-like protein X (MLX) and is involved in the regulation of genes in response to cellular glucose levels. [provided by RefSeq, Mar 2014]
• Synonyms: bHLHe36; MIR; MONDOA
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rabbit: 86%; Mouse: 79%

Reference Data

• Protein Families: Transcription Factors