ZNF195 Rabbit Polyclonal Antibody

SKU TA339446

Rabbit Polyclonal Anti-ZNF195 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF195 antibody: synthetic peptide directed towards the N terminal of human ZNF195. Synthetic peptide located within the following region: GLDNLYLRKDWESLDECKLQKDYNGLNQCSSTTHSKIFQYNKYVKIFDNF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 72 kDa
• Gene Name: zinc finger protein 195
• Database Link:
  NP_001123992
  O14628
• Background: This gene encodes a protein belonging to the Krueppel C2H2-type zinc-finger protein family. These family members are transcription factors that are implicated in a variety of cellular processes. This gene is located near the centromeric border of chromosome 11p15.5, next to an imprinted domain that is associated with maternal-specific loss of heterozygosity in Wilms' tumors. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2012]
• Synonyms: HRF1; ZNFP104
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transcription Factors